PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr0036s0260.1
Common NameMTR_0036s0260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 207aa    MW: 23328.2 Da    PI: 10.0303
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr0036s0260.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.22.8e-112973347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +WT eE++l+  + ++  +g+W+ I+r   k+Rt+ q+ s+ qky
  Medtr0036s0260.1 29 PWTDEEHKLFSVGLQKVDKGDWRGISRNYVKTRTPMQVASHAQKY 73
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.0E-52676IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.8E-132875IPR006447Myb domain, plants
SuperFamilySSF466892.26E-142877IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-72972IPR009057Homeodomain-like
PROSITE profilePS500906.0982974IPR017877Myb-like domain
PfamPF002494.0E-82973IPR001005SANT/Myb domain
CDDcd001674.23E-82974No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MFGAEFLRAV FCVPPVLCVF CEFASGLIPW TDEEHKLFSV GLQKVDKGDW RGISRNYVKT  60
RTPMQVASHA QKYFLCRSNL NRCRRRSSLF DITTDRGYFL LAIVRNVNVR TNLFHLKSLY  120
GATKNRNGSP ISVNKYEQYL SAVAFAVTTF GTVALMSGFF LKPVATLDDY LANVLPLFGG  180
FLSILGVSEV SYMFSFPPNI KFFPRL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.43506e-85flower| glandular trichome| leaf| pod| root| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2297191e-143AC229719.7 Medicago truncatula clone mth2-82f6, complete sequence.
GenBankCT9630781e-143CT963078.4 M.truncatula DNA sequence from clone MTH2-47F5 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013443152.11e-152myb-like DNA-binding domain, shaqkyf class protein
TrEMBLA0A072TIE31e-152A0A072TIE3_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.21e-24MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]